PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g01377.1.p
Common NameBRADI_3g01377, LOC100826254
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 292aa    MW: 30742.1 Da    PI: 7.5754
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g01377.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.22.9e-161562148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g W++eEd++l d++ ++G g+W++++++ g+ R +k+c++rw +yl
  Bradi3g01377.1.p 15 KGLWSPEEDQRLRDYILKHGLGCWSAVPAKAGLQRNGKSCRLRWINYL 62
                      678*******************************************97 PP

2Myb_DNA-binding50.93.6e-1668113148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg +++eE++  +++ ++lG++ W+ Ia +++ gRt++++k++w++yl
  Bradi3g01377.1.p  68 RGMFSQEEEDVVINLQAKLGNK-WSQIAMHLP-GRTDNEVKNYWNSYL 113
                       788*******************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.461062IPR017930Myb domain
SuperFamilySSF466896.24E-2912109IPR009057Homeodomain-like
SMARTSM007171.6E-111464IPR001005SANT/Myb domain
PfamPF002492.2E-141562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.6E-221669IPR009057Homeodomain-like
CDDcd001671.17E-101862No hitNo description
PROSITE profilePS5129425.29563117IPR017930Myb domain
SMARTSM007171.7E-1467115IPR001005SANT/Myb domain
PfamPF002492.4E-1468113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.6E-2570117IPR009057Homeodomain-like
CDDcd001674.45E-1271113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MGCRSCDKPK MNYRKGLWSP EEDQRLRDYI LKHGLGCWSA VPAKAGLQRN GKSCRLRWIN  60
YLRPGLKRGM FSQEEEDVVI NLQAKLGNKW SQIAMHLPGR TDNEVKNYWN SYLKKRVMSS  120
SNSNSRNNPE LLTSMSATTE LIINNGGGSS ATSYDDHDGG NVSAGSHGIS AAPPAAAEPL  180
FDQQQQAAKS FVFADWMPPA AAPPAAAAGP ESYSMSGAHW PASTASSSGT ATPSHAAFLG  240
DQISGGSYAG GAGVSHGGIG PGAGGGGGYF DLLNMGDIYG GFSTTNDDLL F*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-25911723128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3686641e-151AK368664.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2077L03.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003573183.10.0PREDICTED: myb-related protein 305-like
TrEMBLI1HWB40.0I1HWB4_BRADI; Uncharacterized protein
STRINGBRADI3G01377.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP122962735
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52260.13e-54myb domain protein 19